missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Pericentrin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35916-20ul
This item is not returnable.
View return policy
Description
Pericentrin Polyclonal antibody specifically detects Pericentrin in Human,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| Pericentrin | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| Kendrin, KIAA0402, MOPD2, PCN, PCNT2pericentrin B, PCNTB, pericentrin, pericentrin 2 (kendrin), pericentrin, kendrin (KIAA0402)10KENPCTN2, pericentrin-2, pericentrin-380, pericentrin-B, SCKL4kendrin | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 95-212 of human Pericentrin (NP_006022.3).,, Sequence:, GEKREDLEQLQQKQVNDHPPEQCGMFTVSDHPPEQHGMFTVGDHPPEQRGMFTVSDHPPEQHGMFTVSDHPPEQRGMFTISDHQPEQRGMFTVSDHTPEQRGIFTISDHPAEQRGMFT | |
| 20 μL | |
| Cellular Markers, Centrosome Markers | |
| 5116 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction