missing translation for 'onlineSavingsMsg'
Learn More
Learn More
PEBP4 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94404-0.1ml
This item is not returnable.
View return policy
Description
PEBP4 Polyclonal antibody specifically detects PEBP4 in Mouse samples. It is validated for Western Blot
Specifications
| PEBP4 | |
| Polyclonal | |
| Western Blot 1:500-1:1000 | |
| CORK-1, CORK1GWTM1933, cousin-of-RKIP 1 protein, hPEBP4PRO4408, MGC22776, PEBP-4, PEPB4, phosphatidylethanolamine-binding protein 4, Protein cousin-of-RKIP 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 23-120 of human PEBP4 (NP_659399.2). DEDENSPCAHEALLDEDTLFCQGLEVFYPELGNIGCKVVPDCNNYRQKITSWMEPIVKFPGAVDGATYILVMVDPDAPSRAEPRQRFWRHWLVTDIKG | |
| 0.1 mL | |
| Primary | |
| Mouse | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 157310 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction