missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Orai1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 593.00€
Specifications
| Antigen | Orai1 |
|---|---|
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18261382
|
Novus Biologicals
NBP2-57369 |
100 μL |
593.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18625746
|
Novus Biologicals
NBP2-57369-25ul |
25 μL |
369.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Orai1 Polyclonal specifically detects Orai1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Orai1 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Neuroscience | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 84876 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| CRACM1ORAT1, FLJ14466, ORAI calcium release-activated calcium modulator 1, Protein orai-1, TMEM142Acalcium release-activated calcium modulator 1, Transmembrane protein 142Acalcium release-activated calcium channel protein 1 | |
| ORAI1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title