missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Orai1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-57369
This item is not returnable.
View return policy
Description
Orai1 Polyclonal specifically detects Orai1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| Orai1 | |
| Polyclonal | |
| Western Blot 1:100 - 1:250, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| CRACM1ORAT1, FLJ14466, ORAI calcium release-activated calcium modulator 1, Protein orai-1, TMEM142Acalcium release-activated calcium modulator 1, Transmembrane protein 142Acalcium release-activated calcium channel protein 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| ORAI1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQA | |
| 100 μL | |
| Cancer, Neuroscience | |
| 84876 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction