missing translation for 'onlineSavingsMsg'
Learn More
Learn More
OGR1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
204.00€ - 481.00€
Specifications
| Antigen | OGR1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, Knockout Validated |
| Applications | Western Blot, Gene Knock-Out |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18667711
|
Novus Biologicals
NBP2-93067-0.02ml |
0.02 mL |
204.00€
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18623561
|
Novus Biologicals
NBP2-93067-0.1ml |
0.1 mL | |||||||
Description
OGR1 Polyclonal antibody specifically detects OGR1 in Human, Mouse, Rat samples. It is validated for Western Blot, Gene Knock-OutSpecifications
| OGR1 | |
| Western Blot, Gene Knock-Out | |
| Unconjugated | |
| Rabbit | |
| GPCR | |
| PBS (pH 7.3), 50% glycerol | |
| 8111 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, Knockout Validated | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| G protein-coupled receptor 68, GPR12A, G-protein coupled receptor 68, OGR-1, ovarian cancer G protein-coupled receptor, 1, ovarian cancer G-protein coupled receptor 1, Sphingosylphosphorylcholine receptor | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 276-365 of human GPR68 (NP_003476.3). SFNCVADPVLYCFVSETTHRDLARLRGACLAFLTCSRTGRAREAYPLGAPEASGKSGAQGEEPELLTKLHPAFQTPNSPGSGGFPTGRLA | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title