missing translation for 'onlineSavingsMsg'
Learn More

OGR1 Antibody - BSA Free, Novus Biologicals™

Product Code. 18667711 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18667711 0.02 mL 0.02mL
18623561 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18667711 Supplier Novus Biologicals Supplier No. NBP2930670.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

OGR1 Polyclonal antibody specifically detects OGR1 in Human, Mouse, Rat samples. It is validated for Western Blot, Gene Knock-Out
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen OGR1
Applications Western Blot, Gene Knock-Out
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:1000, Knockout Validated
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias G protein-coupled receptor 68, GPR12A, G-protein coupled receptor 68, OGR-1, ovarian cancer G protein-coupled receptor, 1, ovarian cancer G-protein coupled receptor 1, Sphingosylphosphorylcholine receptor
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 276-365 of human GPR68 (NP_003476.3). SFNCVADPVLYCFVSETTHRDLARLRGACLAFLTCSRTGRAREAYPLGAPEASGKSGAQGEEPELLTKLHPAFQTPNSPGSGGFPTGRLA
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Research Discipline GPCR
Primary or Secondary Primary
Gene ID (Entrez) 8111
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.