missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Beschreibung
OGR1 Polyclonal antibody specifically detects OGR1 in Human, Mouse, Rat samples. It is validated for Western Blot, Gene Knock-Out
Spezifikation
Spezifikation
| Antigen | OGR1 |
| Applications | Western Blot, Gene Knock-Out |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:1000, Knockout Validated |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | G protein-coupled receptor 68, GPR12A, G-protein coupled receptor 68, OGR-1, ovarian cancer G protein-coupled receptor, 1, ovarian cancer G-protein coupled receptor 1, Sphingosylphosphorylcholine receptor |
| Host Species | Rabbit |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 276-365 of human GPR68 (NP_003476.3). SFNCVADPVLYCFVSETTHRDLARLRGACLAFLTCSRTGRAREAYPLGAPEASGKSGAQGEEPELLTKLHPAFQTPNSPGSGGFPTGRLA |
| Purification Method | Affinity purified |
| Mehr anzeigen |
Name des Produkts
Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.
Haben Sie Verbesserungsvorschläge?