missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NSUN2 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
188.00€ - 470.00€
Specifications
| Antigen | NSUN2 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18688002
|
Novus Biologicals
NBP2-94855-0.02ml |
0.02 mL |
188.00€
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18620472
|
Novus Biologicals
NBP2-94855-0.1ml |
0.1 mL |
470.00€
0.01mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NSUN2 Polyclonal antibody specifically detects NSUN2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| NSUN2 | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| EC 2.1.1, EC 2.1.1.29, FLJ20303,5-methycytoisine methyltransferase, hTrm4, member 2, Myc-induced SUN-domain-containing protein, NOL1/NOP2/Sun domain family 2, NOL1/NOP2/Sun domain family member 2, NOP2/Sun domain family, member 2, SAKIMisu, Substrate of AIM1/Aurora kinase B, TRM4MISU, tRNA (cytosine-5-)-methyltransferase, tRNA (cytosine-5-)-methyltransferase NSUN2, tRNA methyltransferase 4 homolog | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 617-708 of human NSUN2 (NP_060225.4). SRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEPDSANPDALQCPIVLCGWRGKASIRTFVPKNERLHYLRMMGLEVLG | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 54888 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title