missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NSUN2 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94855-0.02ml
This item is not returnable.
View return policy
Description
NSUN2 Polyclonal antibody specifically detects NSUN2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| NSUN2 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| EC 2.1.1, EC 2.1.1.29, FLJ20303,5-methycytoisine methyltransferase, hTrm4, member 2, Myc-induced SUN-domain-containing protein, NOL1/NOP2/Sun domain family 2, NOL1/NOP2/Sun domain family member 2, NOP2/Sun domain family, member 2, SAKIMisu, Substrate of AIM1/Aurora kinase B, TRM4MISU, tRNA (cytosine-5-)-methyltransferase, tRNA (cytosine-5-)-methyltransferase NSUN2, tRNA methyltransferase 4 homolog | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 617-708 of human NSUN2 (NP_060225.4). SRIITVSMEDVKILLTQENPFFRKLSSETYSQAKDLAKGSIVLKYEPDSANPDALQCPIVLCGWRGKASIRTFVPKNERLHYLRMMGLEVLG | |
| 0.02 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 54888 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction