missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NFYC Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00€ - 470.00€
Specifications
| Antigen | NFYC |
|---|---|
| Dilution | Western Blot 1:100 - 1:500 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18611111
|
Novus Biologicals
NBP2-93399-0.02ml |
0.02 mL |
190.00€
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18602771
|
Novus Biologicals
NBP2-93399-0.1ml |
0.1 mL |
470.00€
0.01mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NFYC Polyclonal antibody specifically detects NFYC in Rat samples. It is validated for Western BlotSpecifications
| NFYC | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Rat | |
| C subunit, nuclear transcription factor Y, gamma | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 27-120 of human NFYC (NP_055038.2). MEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:100 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 4802 | |
| IgG | |
| Affinity purified |
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto