missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NFYC Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93399-0.02ml
This item is not returnable.
View return policy
Description
NFYC Polyclonal antibody specifically detects NFYC in Rat samples. It is validated for Western Blot
Specifications
| NFYC | |
| Polyclonal | |
| Western Blot 1:100 - 1:500 | |
| C subunit, nuclear transcription factor Y, gamma | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 27-120 of human NFYC (NP_055038.2). MEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR | |
| 0.02 mL | |
| Primary | |
| Rat | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 4802 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction