missing translation for 'onlineSavingsMsg'
Learn More

DNA Ligase I Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP2-55992

View more versions of this product

Product Code. 18288072

593.00€ / 100µL

Please sign in to purchase this item. Need a web account? Register with us today!

Questo articolo non è restituibile. Consulta la politica di reso

Descrizione

DNA Ligase I Polyclonal specifically detects DNA Ligase I in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifikationer

Antigen	DNA Ligase I
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Gene Alias	DNA ligase 1, DNA ligase I, EC 6.5.1.1, ligase I, DNA, ATP-dependent, MGC117397, MGC130025, Polydeoxyribonucleotide synthase [ATP] 1, polydeoxyribonucleotide synthase ATP 1
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Applications	Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols	LIG1
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFDLIYLNGESLVREPL
Quantity	100 μL
Research Discipline	Apoptosis, Base Excision Repair, Cancer, DNA Repair, Nucleotide Excision Repair, Tumor Suppressors
Gene ID (Entrez)	3978
Target Species	Human
Isotype	IgG

Produktförslag

Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Ditt namn

E-postadress *

Typ av ärende *

Detaljerad beskrivning av ärendet/förfrågan *

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Avbryt Skicka in

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.

For Research Use Only

Hittar du en möjlighet till förbättring?Dela en innehållskorrigering

DNA Ligase I Antibody, Novus Biologicals™

Descrizione

Specifikationer

Produktförslag

Dokument

Kampanjer