missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNA Ligase I Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 593.00€
Specifications
| Antigen | DNA Ligase I |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18288072
|
Novus Biologicals
NBP2-55992 |
100 μL |
593.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18657926
|
Novus Biologicals
NBP2-55992-25ul |
25 μL |
369.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
DNA Ligase I Polyclonal specifically detects DNA Ligase I in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| DNA Ligase I | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Base Excision Repair, Cancer, DNA Repair, Nucleotide Excision Repair, Tumor Suppressors | |
| DNA ligase 1, DNA ligase I, EC 6.5.1.1, ligase I, DNA, ATP-dependent, MGC117397, MGC130025, Polydeoxyribonucleotide synthase [ATP] 1, polydeoxyribonucleotide synthase ATP 1 | |
| LIG1 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 3978 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFDLIYLNGESLVREPL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto