missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NANS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00€ - 550.00€
Specifications
| Antigen | NANS |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30226901
|
Novus Biologicals
NBP3-38112-100ul |
100 μL |
550.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30227931
|
Novus Biologicals
NBP3-38112-20ul |
20 μL |
190.00€
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
NANS Polyclonal antibody specifically detects NANS in Human samples. It is validated for ELISA,Western BlotSpecifications
| NANS | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| metabolism, Signal Transduction | |
| PBS (pH 7.3), 50% glycerol | |
| 54187 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| EC 2.5.1.56, EC 2.5.1.57, N-acetylneuraminate synthase, N-acetylneuraminate-9-phosphate synthase, N-acetylneuraminic acid phosphate synthase, N-acetylneuraminic acid synthasesialic acid phosphate synthase, SASsialic acid synthase | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 260-359 of human NANS (NP_061819.2).,, Sequence:, AELVRSVRLVERALGSPTKQLLPCEMACNEKLGKSVVAKVKIPEGTILTMDMLTVKVGEPKGYPPEDIFNLVGKKVLVTVEEDDTIMEELVDNHGKKIKS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title