missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MS4A8B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00€ - 550.00€
Specifications
| Antigen | MS4A8B |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30230324
|
Novus Biologicals
NBP3-35124-20ul |
20 μL |
190.00€
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30230777
|
Novus Biologicals
NBP3-35124-100ul |
100 μL |
550.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
MS4A8B Polyclonal antibody specifically detects MS4A8B in Human samples. It is validated for ELISA,Western BlotSpecifications
| MS4A8B | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| 4SPAN4, Four-span transmembrane protein 4, membrane-spanning 4-domains subfamily A member 8B, membrane-spanning 4-domains, subfamily A, member 8B, MS4A4 | |
| A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MS4A8B (NP_113645.1).,, Sequence:, SISFYGGFPFWGGLWFIISGSLSVAAENQPYSYCLLSGSLGLNIVSAICSAVGVILFITDLSIPHPYAYPDYYPYAWGVNPGMAISGVLLVFCLLEFGIAC | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 83661 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title