missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MS4A8B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35124-20ul
This item is not returnable.
View return policy
Description
MS4A8B Polyclonal antibody specifically detects MS4A8B in Human samples. It is validated for ELISA,Western Blot
Specifications
| MS4A8B | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| 4SPAN4, Four-span transmembrane protein 4, membrane-spanning 4-domains subfamily A member 8B, membrane-spanning 4-domains, subfamily A, member 8B, MS4A4 | |
| A synthetic peptide corresponding to a sequence within amino acids 100-200 of human MS4A8B (NP_113645.1).,, Sequence:, SISFYGGFPFWGGLWFIISGSLSVAAENQPYSYCLLSGSLGLNIVSAICSAVGVILFITDLSIPHPYAYPDYYPYAWGVNPGMAISGVLLVFCLLEFGIAC | |
| 20 μL | |
| Primary | |
| Human | |
| Purified |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 83661 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction