missing translation for 'onlineSavingsMsg'
Learn More
Learn More
JAKMIP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-57249
394.40 EUR valid until 2025-12-16
BEST PRICE on Promo! Use promo code "24090" to get your promotional price.
This item is not returnable.
View return policy
Description
JAKMIP1 Polyclonal specifically detects JAKMIP1 in Human samples. It is validated for Western Blot.
Specifications
| JAKMIP1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| JAKMIP1 | |
| Synthetic peptides corresponding to JAKMIP1(janus kinase and microtubule interacting protein 1) The peptide sequence was selected from the middle region of JAKMIP1. Peptide sequence FLRLQVLEQQHVIDDLSLERERLLRSKRHRGKSLKPPKKHVVETFFGFDE. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Guinea pig: 92%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| FLJ31564, GABA-B receptor-binding protein, GABABRBP, JAMIP1Jak and microtubule interacting protein 1, janus kinase and microtubule interacting protein 1, marlin-1, MARLIN1janus kinase and microtubule-interacting protein 1, Multiple alpha-helices and RNA-linker protein 1, multiple coiled-coil GABABR1-binding protein | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 152789 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction