missing translation for 'onlineSavingsMsg'
Learn More
Learn More
JAKMIP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
466.00€
Specifications
| Antigen | JAKMIP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
JAKMIP1 Polyclonal specifically detects JAKMIP1 in Human samples. It is validated for Western Blot.Specifications
| JAKMIP1 | |
| Polyclonal | |
| Rabbit | |
| FLJ31564, GABA-B receptor-binding protein, GABABRBP, JAMIP1Jak and microtubule interacting protein 1, janus kinase and microtubule interacting protein 1, marlin-1, MARLIN1janus kinase and microtubule-interacting protein 1, Multiple alpha-helices and RNA-linker protein 1, multiple coiled-coil GABABR1-binding protein | |
| JAKMIP1 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 152789 | |
| Synthetic peptides corresponding to JAKMIP1(janus kinase and microtubule interacting protein 1) The peptide sequence was selected from the middle region of JAKMIP1. Peptide sequence FLRLQVLEQQHVIDDLSLERERLLRSKRHRGKSLKPPKKHVVETFFGFDE. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title