missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Ku80/XRCC5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
310.00€ - 498.00€
Specifications
| Antigen | Ku80/XRCC5 |
|---|---|
| Dilution | Immunocytochemistry/Immunofluorescence 1-4 ug/ml |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18663288
|
Novus Biologicals
NBP2-55954-25ul |
25 μL |
310.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18250693
|
Novus Biologicals
NBP2-55954 |
100 μL |
498.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Ku80/XRCC5 Polyclonal specifically detects Ku80/XRCC5 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Ku80/XRCC5 | |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 80kDa, ATP-dependent DNA helicase 2 subunit 2, ATP-dependent DNA helicase II 80 kDa subunit, CTC85, CTCBF, EC 3.6.4.-, FLJ39089, G22P2, KARP1, KARP-1, KU80, Ku86 autoantigen related protein 1,86 kDa subunit of Ku antigen, Ku86DNA repair protein XRCC5, KUB2, NFIV, Thyroid-lupus autoantigen, TLAA, X-ray repair complementing defective repair in Chinese hamster cells 5(double-strand-break rejoining)CTC box-binding factor 85 kDa subunit, X-ray repair complementing defective repair in Chinese hamster cells 5(double-strand-break rejoining; Ku autoantigen, 80kD), X-ray repair cross-complementing protein 5, X-ray repair, complementing defective, repair in Chinese hamster | |
| XRCC5 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| Polyclonal | |
| Rabbit | |
| Cancer, Chromatin Research, Core ESC Like Genes, DNA Double Strand Break Repair, DNA Repair, Non homologous end joining, Stem Cell Markers | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 7520 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title