missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Ku80/XRCC5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-55954
This item is not returnable.
View return policy
Description
Ku80/XRCC5 Polyclonal specifically detects Ku80/XRCC5 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| Ku80/XRCC5 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| 80kDa, ATP-dependent DNA helicase 2 subunit 2, ATP-dependent DNA helicase II 80 kDa subunit, CTC85, CTCBF, EC 3.6.4.-, FLJ39089, G22P2, KARP1, KARP-1, KU80, Ku86 autoantigen related protein 1,86 kDa subunit of Ku antigen, Ku86DNA repair protein XRCC5, KUB2, NFIV, Thyroid-lupus autoantigen, TLAA, X-ray repair complementing defective repair in Chinese hamster cells 5(double-strand-break rejoining)CTC box-binding factor 85 kDa subunit, X-ray repair complementing defective repair in Chinese hamster cells 5(double-strand-break rejoining; Ku autoantigen, 80kD), X-ray repair cross-complementing protein 5, X-ray repair, complementing defective, repair in Chinese hamster | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| XRCC5 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQD | |
| 100 μL | |
| Cancer, Chromatin Research, Core ESC Like Genes, DNA Double Strand Break Repair, DNA Repair, Non homologous end joining, Stem Cell Markers | |
| 7520 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction