missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZSCAN1 Partial ORF (NP_872378, 315 a.a. - 407 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00284312-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16102737

  • 335.00€ / 10µg
Estimated Shipment: 30-07-2024
to see stock.
Add to basket

Description

Description

Sequence: REEGPFPCPECGKVFLHNSVLTEHGKIHLLEPPRKKAPRSKGPRESVPPRDGAQGPVAPRSPKRPFQCSVCGKAFPWMVHLIDHQKLHTAHGH
Specifications

Specifications

NP_872378
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.97kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
REEGPFPCPECGKVFLHNSVLTEHGKIHLLEPPRKKAPRSKGPRESVPPRDGAQGPVAPRSPKRPFQCSVCGKAFPWMVHLIDHQKLHTAHGH
RUO
ZSCAN1
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, Protein Array, ELISA, Western Blot
284312
ZSCAN1 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FLJ33779/MGC104472/MZF-1
ZSCAN1
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers