missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human SLC2A4 Partial ORF (NP_001033, 467 a.a. - 509 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00006517-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16105375

  • 335.00€ / 10µg
Estimated Shipment: 24-07-2024
to see stock.
Add to basket

Description

Description

This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM). [provided by RefSeq]

Sequence: RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND
Specifications

Specifications

NP_001033
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
30.47kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND
RUO
SLC2A4
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
6517
SLC2A4 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GLUT4
SLC2A4
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers