missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CDSN Partial ORF (NP_001255, 306 a.a. - 355 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00001041-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16103091

  • 508.00€ / 25µg
Estimated Shipment: 18-07-2024
to see stock.
Add to basket

Description

Description

This gene encodes a protein found in corneodesmosomes, which localize to human epidermis and other cornified squamous epithelia. During maturation of the cornified layers, the protein undergoes a series of cleavages, which are thought to be required for desquamation. The gene is located in the major histocompatibility complex (MHC) class I region on chromosome 6. [provided by RefSeq]

Sequence: YLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNP
Specifications

Specifications

NP_001255
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
31.24kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
YLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNP
RUO
CDSN
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, ELISA, Protein Array, Western Blot
1041
CDSN (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
D6S586E/HTSS/S
CDSN
Recombinant
wheat germ expression system
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers