missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HNRNPCL1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-05586-20ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
HNRNPCL1 Polyclonal antibody specifically detects HNRNPCL1 in Human samples. It is validated for Western Blot
Spécification
| HNRNPCL1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000 | |
| heterogeneous nuclear ribonucleoprotein C-like 1, HNRPCL1, RP5-845O24.4 | |
| A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human HNRNPCL1 (NP_001013653.1). NLEKIEKEQSKQEVEVKNAKSEEEQSSSSMKKDETHVKMESEGGAEDSAEEGDPLDDDVNEDQGDDQLELIKDDEKEAEEGEDDRDSTNGQDDS | |
| 20 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 343069 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu