missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HNRNPCL1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
188.00€ - 463.00€
Specifications
| Antigen | HNRNPCL1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18641319
|
Novus Biologicals
NBP3-05586-100ul |
100 μg |
463.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18656597
|
Novus Biologicals
NBP3-05586-20ul |
20 μg |
188.00€
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HNRNPCL1 Polyclonal antibody specifically detects HNRNPCL1 in Human samples. It is validated for Western BlotSpecifications
| HNRNPCL1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| heterogeneous nuclear ribonucleoprotein C-like 1, HNRPCL1, RP5-845O24.4 | |
| A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human HNRNPCL1 (NP_001013653.1). NLEKIEKEQSKQEVEVKNAKSEEEQSSSSMKKDETHVKMESEGGAEDSAEEGDPLDDDVNEDQGDDQLELIKDDEKEAEEGEDDRDSTNGQDDS | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS with 50% glycerol, pH7.3. | |
| 343069 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title