missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HNRNPCL1 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-05586-20ul
This item is not returnable.
View return policy
Description
HNRNPCL1 Polyclonal antibody specifically detects HNRNPCL1 in Human samples. It is validated for Western Blot
Specifications
| HNRNPCL1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000 | |
| heterogeneous nuclear ribonucleoprotein C-like 1, HNRPCL1, RP5-845O24.4 | |
| A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human HNRNPCL1 (NP_001013653.1). NLEKIEKEQSKQEVEVKNAKSEEEQSSSSMKKDETHVKMESEGGAEDSAEEGDPLDDDVNEDQGDDQLELIKDDEKEAEEGEDDRDSTNGQDDS | |
| 20 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 343069 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction