missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HM74A/PUMA-G/GPR109A/NIACR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 4 publications
379.00€
Specifications
| Antigen | HM74A/PUMA-G/GPR109A/NIACR1 |
|---|---|
| Dilution | Western Blot Reported in scientific literature (PMID 25622782)., Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated Reported in scientific publication (PMID: 32397071). |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
HM74A/PUMA-G/GPR109A/NIACR1 Polyclonal specifically detects HM74A/PUMA-G/GPR109A/NIACR1 in Human, Mouse, Rat, Bovine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
| HM74A/PUMA-G/GPR109A/NIACR1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| GPR109A, HCA2, hydroxycarboxylic acid receptor 2, NIACR1 | |
| HCAR2 | |
| IgG | |
| Affinity Purified | |
| Specificity of human HM74A/PUMA-G/GPR109A/NIACR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot Reported in scientific literature (PMID 25622782)., Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated Reported in scientific publication (PMID: 32397071). | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse, Rat | |
| Q8TDS4 | |
| 338442 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:NRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPEALMANSGEPWSPSYLGP | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title