missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HM74A/PUMA-G/GPR109A/NIACR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 4 publications
Brand: Novus Biologicals NBP1-92180-25ul
This item is not returnable.
View return policy
Description
HM74A/PUMA-G/GPR109A/NIACR1 Polyclonal specifically detects HM74A/PUMA-G/GPR109A/NIACR1 in Human, Mouse, Rat, Bovine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.
Specifications
| HM74A/PUMA-G/GPR109A/NIACR1 | |
| Polyclonal | |
| Western Blot Reported in scientific literature (PMID 25622782)., Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated Reported in scientific publication (PMID: 32397071). | |
| Q8TDS4 | |
| HCAR2 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:NRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPEALMANSGEPWSPSYLGP | |
| 25 μL | |
| Primary | |
| Specificity of human HM74A/PUMA-G/GPR109A/NIACR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| GPR109A, HCA2, hydroxycarboxylic acid receptor 2, NIACR1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 338442 | |
| Human, Mouse, Rat | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction