missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Fc gamma RIIA/CD32a Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
316.00€ - 554.00€
Specifications
| Antigen | Fc gamma RIIA/CD32a |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18456140
|
Novus Biologicals
NBP1-84589-25ul |
25 μL |
316.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18497030
|
Novus Biologicals
NBP1-84589 |
0.1 mL |
554.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Fc gamma RIIA/CD32a Polyclonal antibody specifically detects Fc gamma RIIA/CD32a in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Fc gamma RIIA/CD32a | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Immunology | |
| PBS (pH 7.2) and 40% Glycerol | |
| 2212 | |
| IgG | |
| Immunogen affinity purified |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CD32 antigen, CD32A, CD32MGC23887, CDw32fc-gamma-RIIa, Fc fragment of IgG, low affinity IIa, receptor (CD32), Fc fragment of IgG, low affinity IIa, receptor for (CD32), FCG2, Fc-gamma RII-a, Fc-gamma-RIIa, FcGR, FCGR2, FCGR2A1, FcRII-a, IGFR2MGC30032, IgG Fc receptor II-a, Immunoglobulin G Fc receptor II, low affinity immunoglobulin gamma Fc region receptor II-a | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title