missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Fc gamma RIIA/CD32a Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-84589-25ul
This item is not returnable.
View return policy
Description
Fc gamma RIIA/CD32a Polyclonal antibody specifically detects Fc gamma RIIA/CD32a in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| Fc gamma RIIA/CD32a | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| CD32 antigen, CD32A, CD32MGC23887, CDw32fc-gamma-RIIa, Fc fragment of IgG, low affinity IIa, receptor (CD32), Fc fragment of IgG, low affinity IIa, receptor for (CD32), FCG2, Fc-gamma RII-a, Fc-gamma-RIIa, FcGR, FCGR2, FCGR2A1, FcRII-a, IGFR2MGC30032, IgG Fc receptor II-a, Immunoglobulin G Fc receptor II, low affinity immunoglobulin gamma Fc region receptor II-a | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: RISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDDKNIYLTLPPNDHVNSNN | |
| 25 μL | |
| Immunology | |
| 2212 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction