missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNAJC10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | DNAJC10 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
DNAJC10 Polyclonal specifically detects DNAJC10 in Human samples. It is validated for Western Blot.Specifications
| DNAJC10 | |
| Polyclonal | |
| Rabbit | |
| Q8IXB1 | |
| 54431 | |
| Synthetic peptides corresponding to DNAJC10(DnaJ (Hsp40) homolog, subfamily C, member 10) The peptide sequence was selected from the N terminal of DNAJC10. Peptide sequence DFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAY. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp434J1813, DnaJ (Hsp40) homolog, subfamily C, member 10, dnaJ homolog subfamily C member 10, ERdj5, ER-resident protein ERdj5, J-domain-containing protein disulfide isomerase-like protein, JPDI, macrothioredoxin, MGC104194, MTHr | |
| DNAJC10 | |
| IgG | |
| 91 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title