missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNAJC10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-59668
This item is not returnable.
View return policy
Description
DNAJC10 Polyclonal specifically detects DNAJC10 in Human samples. It is validated for Western Blot.
Specifications
| DNAJC10 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| DKFZp434J1813, DnaJ (Hsp40) homolog, subfamily C, member 10, dnaJ homolog subfamily C member 10, ERdj5, ER-resident protein ERdj5, J-domain-containing protein disulfide isomerase-like protein, JPDI, macrothioredoxin, MGC104194, MTHr | |
| Rabbit | |
| 91 kDa | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Chicken: 92%; Guinea pig: 92%; Equine: 92%; Zebrafish: 83%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q8IXB1 | |
| DNAJC10 | |
| Synthetic peptides corresponding to DNAJC10(DnaJ (Hsp40) homolog, subfamily C, member 10) The peptide sequence was selected from the N terminal of DNAJC10. Peptide sequence DFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAY. | |
| Affinity purified | |
| RUO | |
| 54431 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction