missing translation for 'onlineSavingsMsg'
Learn More
Learn More
DNA Ligase I Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-55992-25ul
This item is not returnable.
View return policy
Description
DNA Ligase I Polyclonal specifically detects DNA Ligase I in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| DNA Ligase I | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| DNA ligase 1, DNA ligase I, EC 6.5.1.1, ligase I, DNA, ATP-dependent, MGC117397, MGC130025, Polydeoxyribonucleotide synthase [ATP] 1, polydeoxyribonucleotide synthase ATP 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°CC long term. Avoid freeze/thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| LIG1 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAFDLIYLNGESLVREPL | |
| 25 μL | |
| Apoptosis, Base Excision Repair, Cancer, DNA Repair, Nucleotide Excision Repair, Tumor Suppressors | |
| 3978 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction