missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cytochrome P450 1A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
214.00€ - 584.00€
Specifications
| Antigen | Cytochrome P450 1A1 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Applications | ELISA, Western Blot, Immunocytochemistry/Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30232558
|
Novus Biologicals
NBP3-37955-100ul |
100 μL |
584.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30229977
|
Novus Biologicals
NBP3-37955-20ul |
20 μL |
214.00€
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Cytochrome P450 1A1 Polyclonal antibody specifically detects Cytochrome P450 1A1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ImmunofluorescenceSpecifications
| Cytochrome P450 1A1 | |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Breast Cancer, Lipid and Metabolism | |
| PBS (pH 7.3), 50% glycerol | |
| 1543 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| AHH, AHRR, aryl hydrocarbon hydroxylase, CP11, CYP1, CYPIA1, cytochrome P1-450, dioxin-inducible, cytochrome P450 1A1, Cytochrome P450 form 6, cytochrome P450, family 1, subfamily A, polypeptide 1, Cytochrome P450-C, Cytochrome P450-P1, EC 1.14.14.1, flavoprotein-linked monooxygenase, P1-450, P450-C, P450DX, subfamily I (aromatic compound-inducible), polypeptide 1, xenobiotic monooxygenase | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 200-460 of human Cytochrome P450 1A1 (NP_000490.1).,, Sequence:, NPYRYVVVSVTNVICAICFGRRYDHNHQELLSLVNLNNNFGEVVGSGNPADFIPILRYLPNPSLNAFKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANVQLSDEKIINIVLDLFG | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title