missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cytochrome P450 1A1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-37955-20ul
This item is not returnable.
View return policy
Description
Cytochrome P450 1A1 Polyclonal antibody specifically detects Cytochrome P450 1A1 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| Cytochrome P450 1A1 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| AHH, AHRR, aryl hydrocarbon hydroxylase, CP11, CYP1, CYPIA1, cytochrome P1-450, dioxin-inducible, cytochrome P450 1A1, Cytochrome P450 form 6, cytochrome P450, family 1, subfamily A, polypeptide 1, Cytochrome P450-C, Cytochrome P450-P1, EC 1.14.14.1, flavoprotein-linked monooxygenase, P1-450, P450-C, P450DX, subfamily I (aromatic compound-inducible), polypeptide 1, xenobiotic monooxygenase | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 200-460 of human Cytochrome P450 1A1 (NP_000490.1).,, Sequence:, NPYRYVVVSVTNVICAICFGRRYDHNHQELLSLVNLNNNFGEVVGSGNPADFIPILRYLPNPSLNAFKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANVQLSDEKIINIVLDLFG | |
| 20 μL | |
| Breast Cancer, Lipid and Metabolism | |
| 1543 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction