missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CML2 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
190.00€ - 463.00€
Specifications
| Antigen | CML2 |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18668891
|
Novus Biologicals
NBP2-92803-0.02ml |
0.02 mL |
190.00€
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18650092
|
Novus Biologicals
NBP2-92803-0.1ml |
0.1 mL |
463.00€
0.01mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CML2 Polyclonal antibody specifically detects CML2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| CML2 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cell Biology | |
| PBS with 50% glycerol, pH7.3. | |
| 51471 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| Camello-like protein 2, CML2, EC 2.3.1, EC 2.3.1.-, Hcml2, MGC97061, N-acetyltransferase 8B (GCN5-related, putative, gene/pseudogene), N-acetyltransferase 8B (gene/pseudogene), N-acetyltransferase Camello 2, NAT8BP, probable N-acetyltransferase 8B | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 75-165 of human NAT8B (NP_057431.2). WFLAKKPWTRYVDIALRTDMSDITKSYLSECGSCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKALVRTVLQFA | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title