missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CML2 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92803-0.1ml
This item is not returnable.
View return policy
Description
CML2 Polyclonal antibody specifically detects CML2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| CML2 | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin | |
| Camello-like protein 2, CML2, EC 2.3.1, EC 2.3.1.-, Hcml2, MGC97061, N-acetyltransferase 8B (GCN5-related, putative, gene/pseudogene), N-acetyltransferase 8B (gene/pseudogene), N-acetyltransferase Camello 2, NAT8BP, probable N-acetyltransferase 8B | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 75-165 of human NAT8B (NP_057431.2). WFLAKKPWTRYVDIALRTDMSDITKSYLSECGSCFWVGESEEKVVGTVGALPVDDPTLREKRLQLFHLSVDNEHRGQGIAKALVRTVLQFA | |
| 0.1 mL | |
| Cell Biology | |
| 51471 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction