missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cdk6 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
237.00€ - 518.00€
Specifications
| Antigen | Cdk6 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunoprecipitation 1:50 - 1:100, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18667261
|
Novus Biologicals
NBP2-92967-0.02ml |
0.02 mL |
237.00€
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18657711
|
Novus Biologicals
NBP2-92967-0.1ml |
0.1 mL |
518.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Cdk6 Polyclonal antibody specifically detects Cdk6 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)Specifications
| Cdk6 | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication, Ovarian Carcinoma Cell Markers | |
| PBS with 50% glycerol, pH7.3. | |
| 1021 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunoprecipitation 1:50 - 1:100, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| Cell division protein kinase 6, cyclin-dependent kinase 6, EC 2.7.11, EC 2.7.11.22, PLSTIREMGC59692, Serine/threonine-protein kinase PLSTIRE | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 226-326 of human Cdk6 (NP_001250.1). DQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title