missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cdk6 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92967-0.02ml
This item is not returnable.
View return policy
Description
Cdk6 Polyclonal antibody specifically detects Cdk6 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Specifications
| Cdk6 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunoprecipitation 1:50 - 1:100, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Cell division protein kinase 6, cyclin-dependent kinase 6, EC 2.7.11, EC 2.7.11.22, PLSTIREMGC59692, Serine/threonine-protein kinase PLSTIRE | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 226-326 of human Cdk6 (NP_001250.1). DQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA | |
| 0.02 mL | |
| Cell Cycle and Replication, Ovarian Carcinoma Cell Markers | |
| 1021 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction