missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD163 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
294.00€ - 523.00€
Specifications
| Antigen | CD163 |
|---|---|
| Dilution | Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18681149
|
Novus Biologicals
NBP2-48846-25ul |
25 μL |
294.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18639115
|
Novus Biologicals
NBP2-48846 |
0.1 mL |
523.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CD163 Polyclonal antibody specifically detects CD163 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| CD163 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Angiogenesis, Immune System Diseases, Immunology, Inflammation, Innate Immunity | |
| PBS (pH 7.2), 40% Glycerol | |
| 9332 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CD_antigen: CD163, CD163, CD163 molecule, Hemoglobin scavenger receptor, M130, macrophage-associated antigen, MM130, SCARI1, scavenger receptor cysteine-rich type 1 protein M130, sCD163, Soluble CD163 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SRGENLVHQIQYREMNSCLNADDLDLMNSSENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGN | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title