missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD163 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-48846
This item is not returnable.
View return policy
Description
CD163 Polyclonal antibody specifically detects CD163 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| CD163 | |
| Polyclonal | |
| Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| CD_antigen: CD163, CD163, CD163 molecule, Hemoglobin scavenger receptor, M130, macrophage-associated antigen, MM130, SCARI1, scavenger receptor cysteine-rich type 1 protein M130, sCD163, Soluble CD163 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SRGENLVHQIQYREMNSCLNADDLDLMNSSENSHESADFSAAELISVSKFLPISGMEKEAILSHTEKENGN | |
| 0.1 mL | |
| Angiogenesis, Immune System Diseases, Immunology, Inflammation, Innate Immunity | |
| 9332 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction