missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCR11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | CCR11 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CCR11 Polyclonal specifically detects CCR11 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CCR11 | |
| Polyclonal | |
| Rabbit | |
| NP_057641 | |
| 51554 | |
| IgG | |
| 39 kDa |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| CC chemokine receptor-like 1, C-C CKR-11, CCBP2CCX CKR, CCR11CCR10, chemokine (C-C motif) receptor-like 1, orphan seven-transmembrane receptor, chemokine related, PPR1cc motif, receptor-like protein 1, VSHK1CKR-11 | |
| The specific Immunogen is proprietary information. Peptide sequence SIALFHSCLNPILYVFMGASFKNYVMKVAKKYGSWRRQRQSVEEFPFDSE. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title