missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCR11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-79925
This item is not returnable.
View return policy
Description
CCR11 Polyclonal specifically detects CCR11 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| CCR11 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| CC chemokine receptor-like 1, C-C CKR-11, CCBP2CCX CKR, CCR11CCR10, chemokine (C-C motif) receptor-like 1, orphan seven-transmembrane receptor, chemokine related, PPR1cc motif, receptor-like protein 1, VSHK1CKR-11 | |
| Rabbit | |
| 39 kDa | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Dog: 86%; Rat: 86%; Rabbit: 86%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
| NP_057641 | |
| ACKR4 | |
| The specific Immunogen is proprietary information. Peptide sequence SIALFHSCLNPILYVFMGASFKNYVMKVAKKYGSWRRQRQSVEEFPFDSE. | |
| Affinity purified | |
| RUO | |
| 51554 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction