missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Carbonic Anhydrase VII/CA7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | Carbonic Anhydrase VII/CA7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Carbonic Anhydrase VII/CA7 Polyclonal specifically detects Carbonic Anhydrase VII/CA7 in Human samples. It is validated for Western Blot.Specifications
| Carbonic Anhydrase VII/CA7 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| Carbonate dehydratase VII, carbonic anhydrase 7, carbonic anhydrase VIICAVII, carbonic dehydratase VII, CA-VII, EC 4.2.1.1 | |
| CA7 | |
| IgG | |
| 23 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q86YU0 | |
| 766 | |
| Synthetic peptides corresponding to CA7 (carbonic anhydrase VII) The peptide sequence was selected from the C terminal of CA7. Peptide sequence SLTTPPLSESVTWIVLREPICISERQMGKFRSLLFTSEDDERIHMVNNFR. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title