missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BTAF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
426.00€ - 589.00€
Specifications
| Antigen | BTAF1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18292682
|
Novus Biologicals
NBP2-57414 |
100 μL |
589.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18692497
|
Novus Biologicals
NBP2-57414-25ul |
25 μL |
426.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
BTAF1 Polyclonal specifically detects BTAF1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| BTAF1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| ATP-dependent helicase BTAF1, BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170kDa (Mot1homolog, S. cerevisiae), B-TFIID transcription factor-associated 170 kDa subunit, EC 3.6.1, EC 3.6.4.-, MOT1MGC138406, TAF(II)170KIAA0940, TAF-172, TAF172BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170 kD (Mot1homolog, S. cerevisiae), TAFII170TATA-binding protein-associated factor 172, TBP-associated factor 172 | |
| BTAF1 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 9044 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QFAARYGKPILASRDARSSSREQEAGVLAMDALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCTLSPLQVQLYEDFAKSRAKCDVDETVSSATLS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title