IL-15 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marke: Novus Biologicals NBP2-55162-25ul

Lernen Sie weitere Varianten dieses

Artikelnummer. 18683907

302.00€ / 25µL

Please sign in to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

IL-15 Polyclonal specifically detects IL-15 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Spezifikation

Antigen	IL-15
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
Gene Alias	IL-15MGC9721, interleukin 15, interleukin-15
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

Applications	Immunocytochemistry, Immunofluorescence, Immunofluorescence
Conjugate	Unconjugated
Formulation	PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols	IL15
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Quantity	25 μL
Research Discipline	Cell Cycle and Replication, Cytokine Research, Immune System Diseases, Immunology, Innate Immunity
Gene ID (Entrez)	3600
Target Species	Human, Canine
Isotype	IgG

Produktvorschläge

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Ihr Name

E-Mail Adresse *

Art der Problems *

Detaillierte Beschreibung des Problems/der Anfrage *

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Abbrechen Absenden

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt

For Research Use Only

Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur

IL-15 Antibody, Novus Biologicals™

Beschreibung

Spezifikation

Produktvorschläge

Dokumentation

Aktionen