missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IL-15 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
302.00€ - 513.00€
Specifications
| Antigen | IL-15 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18093236
|
Novus Biologicals
NBP2-55162 |
100 μL |
513.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18683907
|
Novus Biologicals
NBP2-55162-25ul |
25 μL |
302.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
IL-15 Polyclonal specifically detects IL-15 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| IL-15 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Cytokine Research, Immune System Diseases, Immunology, Innate Immunity | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 3600 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| IL-15MGC9721, interleukin 15, interleukin-15 | |
| IL15 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title