missing translation for 'onlineSavingsMsg'
Learn More
Learn More
APOBEC3F Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
198.00€ - 462.00€
Specifications
| Antigen | APOBEC3F |
|---|---|
| Dilution | Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
APOBEC3F Polyclonal antibody specifically detects APOBEC3F in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| APOBEC3F | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Immunology | |
| PBS with 50% glycerol, pH7.3. | |
| 200316 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F, Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3F, ARP8, BK150C2.4.MRNA, DNA dC->dU-editing enzyme APOBEC-3F, EC 3.5.4, EC 3.5.4.-, induced upon T-cell activation, KA6, MGC74891 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human APOBEC3F (NP_660341.2). MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVYSQPEHH | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title