missing translation for 'onlineSavingsMsg'
Learn More
Learn More
APOBEC3F Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92770-0.02ml
This item is not returnable.
View return policy
Description
APOBEC3F Polyclonal antibody specifically detects APOBEC3F in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| APOBEC3F | |
| Polyclonal | |
| Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunohistochemistry-Paraffin | |
| apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F, Apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like 3F, ARP8, BK150C2.4.MRNA, DNA dC->dU-editing enzyme APOBEC-3F, EC 3.5.4, EC 3.5.4.-, induced upon T-cell activation, KA6, MGC74891 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-65 of human APOBEC3F (NP_660341.2). MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVYSQPEHH | |
| 0.02 mL | |
| Immunology | |
| 200316 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction