missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AE2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92513-0.02ml
This item is not returnable.
View return policy
Description
AE2 Polyclonal antibody specifically detects AE2 in Human samples. It is validated for Western Blot
Specifications
| AE2 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| AE 2, AE2anion exchanger 2 type a, Anion exchanger 2, anion exchanger 2 type b2, BND3LHKB3anion exchange protein 2, EPB3L1anion exchanger 2 type b1, FLJ59028, MPB3L, NBND3, Non-erythroid band 3-like protein, Solute carrier family 4 member 2, solute carrier family 4, anion exchanger, member 2 (erythrocyte membraneprotein band 3-like 1) | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human SLC4A2 (NP_001186623.1). DDGGASGRPLPKAQPGHRSYNLQERRRIGSMTGAEQALLPRVPTDEIEAQTLATADLDLMKSHRFEDVPGVRRHLVRKNAKGSTQSGREGREPGPTPRARP | |
| 0.02 mL | |
| Cardiovascular Biology, Endocrinology, Signal Transduction | |
| 6522 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur