missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AE2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
204.00€ - 476.00€
Specifications
| Antigen | AE2 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18637412
|
Novus Biologicals
NBP2-92513-0.02ml |
0.02 mL |
204.00€
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18627352
|
Novus Biologicals
NBP2-92513-0.1ml |
0.1 mL |
476.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
AE2 Polyclonal antibody specifically detects AE2 in Human samples. It is validated for Western BlotSpecifications
| AE2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cardiovascular Biology, Endocrinology, Signal Transduction | |
| PBS with 50% glycerol, pH7.3. | |
| 6522 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| AE 2, AE2anion exchanger 2 type a, Anion exchanger 2, anion exchanger 2 type b2, BND3LHKB3anion exchange protein 2, EPB3L1anion exchanger 2 type b1, FLJ59028, MPB3L, NBND3, Non-erythroid band 3-like protein, Solute carrier family 4 member 2, solute carrier family 4, anion exchanger, member 2 (erythrocyte membraneprotein band 3-like 1) | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 200-300 of human SLC4A2 (NP_001186623.1). DDGGASGRPLPKAQPGHRSYNLQERRRIGSMTGAEQALLPRVPTDEIEAQTLATADLDLMKSHRFEDVPGVRRHLVRKNAKGSTQSGREGREPGPTPRARP | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title